ARID3B

Product Description for ARID3B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine ARID3B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	ARID domain-containing protein 3B, AT-rich interactive domain-containing protein 3B, BDP, Bright and dead ringer protein, Bright-like, DRIL2
Presentation	Purified
Reactivity	Bov, Can, Eq, GP, Hu, Ms, Por
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Immunogen	Swiss Prot Num: Q8IVW6 Immunogen: The immunogen for Anti-ARID3B Antibody: synthetic peptide directed towards the N terminal of human ARID3B. Synthetic peptide located within the following region: DPRVAPMSNLLPAPGLPPHGQQAKEDHTKDASKASPSVSTAGQPNWNLDE. GeneID: 10620
Application	WB
Background	ARID3B is a member of the ARID (AT-rich interaction domain) family of D-binding proteins. The protein is homologous with two proteins that bind to the retinoblastoma gene product, and also with the mouse Bright and Drosophila dead ringer proteins. Members of the ARID family have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptiol regulation and possibly in chromatin structure modification. This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind D. It is homologous with two proteins that bind to the retinoblastoma gene product and also with the mouse Bright and Drosophila dead ringer proteins. A pseudogene on chromosome 1p31 also exists for this gene. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptiol regulation and possibly in chromatin structure modification.
Format	Purification: Protein A purified Buffer System: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Catalog No.	Species	Pres.	Purity	Source
TP710177	ARID3B (C-term DDK tag)
	Human		> 80 % Preparation: . Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	SF9 cells	20 µg / €411.00
					OriGene Technologies, Inc.
H00010620-P01-10	ARID3B
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00010620-P01-25	ARID3B
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
P0464	ARID3B
	Human
					Abnova Taiwan Corp.

Catalog No.	Species
H00010620-T01	ARID3B 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
LY416624	ARID3B overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH