TA335691 TM9SF1 antibody

Rabbit Polyclonal Anti-TM9SF1 Antibody

See related secondary antibodies

Search for all "TM9SF1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TM9SF1

Product Description for TM9SF1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TM9SF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TM9SF1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Transmembrane 9 superfamily member 1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O15321
Immunogen:
The immunogen for Anti-TM9SF1 Antibody: synthetic peptide directed towards the N terminal of human TM9SF1. Synthetic peptide located within the following region: YMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLR.
GeneID:
10548
Application WB
Background TM9SF1 may function as channel, small molecule transporter or receptor.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TM9SF1 (1 products)

Catalog No. Species Pres. Purity   Source  

TM9SF1 (transcript variant 1)

TM9SF1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for TM9SF1 (1 products)

Catalog No. Species Pres. Purity   Source  

TM9SF1 overexpression lysate

TM9SF1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn