TA335693 ARIH2 / TRIAD1 antibody

Rabbit Polyclonal Anti-ARIH2 Antibody

See related secondary antibodies

Search for all "ARIH2 / TRIAD1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, African clawed frog ARIH2 / TRIAD1

TA335693

More Views

  • TA335693
  • TA335693

Product Description for ARIH2 / TRIAD1

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, African clawed frog ARIH2 / TRIAD1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ARIH2 / TRIAD1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ARI2, HT005, Protein ariadne-2 homolog
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Can, Chk, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95376
Immunogen:
The immunogen for anti-ARIH2 antibody: synthetic peptide directed towards the N terminal of human ARIH2
AA Sequence:
EDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCL
GeneID:
10425
Application Western blotting (1 - 4 µg/ml)
Immunohistochemsitry on paraffin embedded sections (4 - 8 µg/ml)
Background ARIH2 might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, such as UBE2L3/UBCM4, and then transfers it to substrates.
General Readings Marteijn,J.A., (2005) Blood 106 (13), 4114-4123
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using Protein A affinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, Bovine, Chicken, African clawed frog
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for ARIH2 / TRIAD1 (5 products)

Catalog No. Species Pres. Purity   Source  

ARIH2 / TRIAD1

ARIH2 / TRIAD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ARIH2 / TRIAD1

ARIH2 / TRIAD1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ARIH2 / TRIAD1

ARIH2 / TRIAD1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ARIH2 / TRIAD1

ARIH2 / TRIAD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ARIH2 / TRIAD1

ARIH2 / TRIAD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ARIH2 / TRIAD1 (2 products)

Catalog No. Species Pres. Purity   Source  

ARIH2 Lysate

Western Blot: ARIH2 Lysate [NBL1-07686] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ARIH2 Protein
  Novus Biologicals Inc.

ARIH2 / TRIAD1 Lysate(Denatured)

ARIH2 / TRIAD1 Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn