TA335702 alpha Tubulin / TUBA3C / TUBA2 antibody

Rabbit Polyclonal Anti-TUBA3C Antibody

See related secondary antibodies

Search for all "alpha Tubulin / TUBA3C / TUBA2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Porcine, Rabbit, Rat, Zebrafish alpha Tubulin / TUBA3C / TUBA2

TA335702

More Views

  • TA335702
  • TA335702

Product Description for alpha Tubulin / TUBA3C / TUBA2

Rabbit anti Human, Mouse, Porcine, Rabbit, Rat, Zebrafish alpha Tubulin / TUBA3C / TUBA2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for alpha Tubulin / TUBA3C / TUBA2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Alpha-tubulin 2, Alpha-tubulin 3C/D, TUBA3D, Tubulin alpha-2 chain, Tubulin alpha-3C/D chain
Presentation Purified
Reactivity Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13748
Immunogen:
The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL.
GeneID:
113457
Application WB
Background Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome.Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for alpha Tubulin / TUBA3C / TUBA2 (1 products)

Catalog No. Species Pres. Purity   Source  

alpha Tubulin / TUBA3C / TUBA2

alpha Tubulin / TUBA3C / TUBA2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for alpha Tubulin / TUBA3C / TUBA2 (3 products)

Catalog No. Species Pres. Purity   Source  

alpha Tubulin 3c Lysate

Western Blot: alpha Tubulin 3c Lysate [NBL1-17430] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TUBA3C
  Novus Biologicals Inc.

H2-ALPHA 293T Cell Transient Overexpression Lysate(Denatured)

H2-ALPHA 293T Cell Transient Overexpression Lysate(Denatured) Transient overexpression cell lysate was tested with Anti-H2-ALPHA antibody (H00113457-B01) by Western Blots.
  Abnova Taiwan Corp.

TUBA3D Lysate

Western Blot: TUBA3D Lysate [NBL1-17431] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TUBA3D
  Novus Biologicals Inc.
  • LinkedIn