TA335704 SOX1 antibody

Rabbit Polyclonal Anti-SOX1 Antibody

See related secondary antibodies

Search for all "SOX1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit SOX1

Product Description for SOX1

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit SOX1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SOX1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SRY-box 1, Transcription factor SOX-1
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00570
Immunogen:
The immunogen for Anti-SOX1 Antibody: synthetic peptide directed towards the C terminal of human SOX1. Synthetic peptide located within the following region: ALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPAGEGGDPAAAAAA.
GeneID:
6656
Application WB
Background SOX1 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determition of the cell fate. SOX1 may act as a transcriptiol activator after forming a protein complex with other proteins. In mice, a similar protein regulates the gamma-crystallin genes and is essential for lens development.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SOX1 (2 products)

Catalog No. Species Pres. Purity   Source  

SOX1

SOX1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SOX1

SOX1 Human
  Abnova Taiwan Corp.

Positive controls for SOX1 (2 products)

Catalog No. Species Pres. Purity   Source  

SOX1 Lysate

Western Blot: SOX1 Lysate [NBL1-16343] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SOX1
  Novus Biologicals Inc.

SOX1 overexpression lysate

SOX1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn