TA335711 MAMLD1 antibody

Rabbit Polyclonal Anti-MAMLD1 Antibody

See related secondary antibodies

Search for all "MAMLD1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse, African clawed frog MAMLD1

Product Description for MAMLD1

Rabbit anti Canine, Human, Mouse, African clawed frog MAMLD1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for MAMLD1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CXorf6, F18, Mastermind-like domain-containing protein 1, Protein CG1
Presentation Aff - Purified
Reactivity African clawed frog, Can, Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13495
Immunogen:
The immunogen for anti-CXORF6 antibody: synthetic peptide directed towards the N terminal of human CXORF6
AA Sequence:
LEELTKIQDPSPNELDLEKILGTKPEEPLVLDHPQATLSTTPKPSVQMSH
GeneID:
10046
Application

Western blotting (1 - 3 µg/ml)

Background Mastermind-like domain-containing protein 1 or CXorf6 transactivates the HES3 promoter independently of NOTCH proteins. HES3 is a non-canonical NOTCH target gene which lacks binding sites for RBPJ. MAMLD1 is expressed in fetal brain, fetal ovary, fetal testis, adult brain, ovary, skin, testis, uterus and highly expressed in skeletal muscle. Defects in MAMLD1 are a cause of X-linked hypospadias type 2 (HYSP2). Hypospadias is a common malformation in which the urethra opens on the ventral side of the penis. It is considered a complex disorder with both genetic and environmental factors involved in the pathogenesis. Hypospadias can occur alone on an apparently multifactorial basis or as part of syndromes.
General Readings "Mastermind-like domain-containing 1 (MAMLD1 or CXorf6) transactivates the Hes3 promoter, augments testosterone production, and contains the SF1 target sequence." Fukami M., Wada Y., Okada M., Kato F., Katsumata N., Baba T., Morohashi K., Laporte J., Kitagawa M., Ogata T. J. Biol. Chem. 283:5525-5532(2008)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using Protein A affinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, African clawed frog, Dog
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for MAMLD1 (3 products)

Catalog No. Species Pres. Purity   Source  

MAMLD1

MAMLD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MAMLD1

MAMLD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MAMLD1

MAMLD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MAMLD1 (1 products)

Catalog No. Species Pres. Purity   Source  

MAMLD1 overexpression lysate

MAMLD1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn