TA335725 SFRS17A antibody

Rabbit Polyclonal Anti-AKAP17A Antibody

See related secondary antibodies

Search for all "SFRS17A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Rat SFRS17A

TA335725

More Views

  • TA335725

Product Description for SFRS17A

Rabbit anti Canine, Equine, Human, Rat SFRS17A.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SFRS17A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 721P, Activated B-Cell marker, B-lymphocyte antigen, CXYorf3, DXYS155E, Splicing factor, XE7, arginine/serine-rich 17A
Presentation Purified
Reactivity Can, Eq, Hu, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q02040
Immunogen:
The immunogen for Anti-DXYS155E Antibody: synthetic peptide directed towards the N terminal of human DXYS155E. Synthetic peptide located within the following region: NWEVMERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLD.
GeneID:
8227
Application WB
IHC
Background DXYS155E is a gene found in the pseudoautosomal region of the distal short arms of the X and Y chromosomes, and appears to be ubiquitously expressed.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SFRS17A (2 products)

Catalog No. Species Pres. Purity   Source  

SFRS17A

SFRS17A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SFRS17A

SFRS17A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SFRS17A (1 products)

Catalog No. Species Pres. Purity   Source  

RP13-297E16.1 293T Cell Transient Overexpression Lysate(Denatured)

RP13-297E16.1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn