TA335729 PDE1A antibody

Rabbit Polyclonal Anti-PDE1A Antibody

See related secondary antibodies

Search for all "PDE1A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat PDE1A

Product Description for PDE1A

Rabbit anti Canine, Human, Mouse, Rat PDE1A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PDE1A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 5'-cyclic nucleotide phosphodiesterase 1A, 61 kDa Cam-PDE, Calcium/calmodulin-dependent 3', Cam-PDE 1A, HCAM1, HSPDE1A, Phosphodiesterase 1A, Phosphodiesterase-1A calmodulin-dependent, hCam-1
Presentation Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P54750
Immunogen:
The immunogen for Anti-PDE1A Antibody: synthetic peptide directed towards the C terminal of human PDE1A. Synthetic peptide located within the following region: AVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDET.
GeneID:
5136
Application WB
Background PDE1A belongs to the cyclic nucleotide phosphodiesterase family. It has a higher affinity for cGMP than for cAMP. The exact function of PDE1A remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PDE1A (5 products)

Catalog No. Species Pres. Purity   Source  

PDE1A (transcript variant 1)

PDE1A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PDE1A

PDE1A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PDE1A

PDE1A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PDE1A

PDE1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PDE1A

PDE1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PDE1A (3 products)

Catalog No. Species Pres. Purity   Source  

PDE1A 293T Cell Transient Overexpression Lysate(Denatured)

PDE1A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PDE1A Lysate

Western Blot: PDE1A Lysate [NBL1-14214] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PDE1A
  Novus Biologicals Inc.

PDE1A overexpression lysate

PDE1A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn