TA335743 YBX1 antibody

Rabbit Polyclonal Anti-NSEP1 Antibody

See related secondary antibodies

Search for all "YBX1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat, Sheep YBX1

Product Description for YBX1

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat, Sheep YBX1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for YBX1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CBF-A, CCAAT-binding transcription factor I subunit A, DNA-binding protein B, EFI-A, Enhancer factor I subunit A, NSEP1, Nuclease-sensitive element-binding protein 1, Y-box transcription factor, Y-box-binding protein 1, YB-1, YB1
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P67809
Immunogen:
The immunogen for Anti-NSEP1 Antibody: synthetic peptide directed towards the C terminal of human NSEP1. Synthetic peptide located within the following region: NMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNF.
GeneID:
4904
Application WB
Background NSEP1 is a cell cycle stage-specific transcription factor important for cell proliferation. NSEP1 encodes a protein that correlates with P-glycoprotein expression in human breast carcinoma.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for YBX1 (9 products)

Catalog No. Species Pres. Purity   Source  

YBX1

YBX1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

YBX1 (1-324, His-tag)

YBX1 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

YBX1 (1-324, His-tag)

YBX1 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

YBX1

YBX1 Human Purified
  Abnova Taiwan Corp.

YBX1

YBX1 Human Purified
  Abnova Taiwan Corp.

YBX1

YBX1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

YBX1

YBX1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

YBX1

YBX1 Human
  Abnova Taiwan Corp.

YBX1

YBX1 Human
  Abnova Taiwan Corp.

Positive controls for YBX1 (1 products)

Catalog No. Species Pres. Purity   Source  

YBX1 overexpression lysate

YBX1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn