TA335746 PSMA / FOLH1 antibody

Rabbit Polyclonal Anti-FOLH1 Antibody

See related secondary antibodies

Search for all "PSMA / FOLH1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat PSMA / FOLH1

Product Description for PSMA / FOLH1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat PSMA / FOLH1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PSMA / FOLH1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FOLH, Folate hydrolase 1, Folylpoly-gamma-glutamate carboxypeptidase, GCP2, Glutamate carboxypeptidase 2, Glutamate carboxypeptidase II, Membrane glutamate carboxypeptidase, N-acetylated-alpha-linked acidic dipeptidase I, NAALAD1, NAALAdase, PSM, Prostate-specific membrane antigen, Pteroylpoly-gamma-glutamate carboxypeptidase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q04609
Immunogen:
The immunogen for Anti-FOLH1 Antibody: synthetic peptide directed towards the C terminal of human FOLH1. Synthetic peptide located within the following region: FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA.
GeneID:
2346
Application WB
Background FOLH1 is a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different altertive substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. A mutation in the gene encoding FOLH1 may be associated with impaired intestil absorption of dietary folates.It is used as an effective diagnostic and prognostic indicator of prostate cancer.This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different altertive substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestil absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Altertive splicing gives rise to multiple transcript variants.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PSMA / FOLH1 (5 products)

Catalog No. Species Pres. Purity   Source  

PSMA / FOLH1 (transcript variant 1)

PSMA / FOLH1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PSMA / FOLH1

PSMA / FOLH1 Human Purified
  Abnova Taiwan Corp.

PSMA / FOLH1

PSMA / FOLH1 Human Purified
  Abnova Taiwan Corp.

PSMA / FOLH1

PSMA / FOLH1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PSMA / FOLH1

PSMA / FOLH1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PSMA / FOLH1 (3 products)

Catalog No. Species Pres. Purity   Source  

FOLH1 overexpression lysate

FOLH1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

FOLH1 overexpression lysate

FOLH1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

PSMA Lysate

Western Blot: PSMA Lysate [NBL1-10789] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FOLH1
  Novus Biologicals Inc.
  • LinkedIn