TA335750 ASPH antibody

Rabbit Polyclonal Anti-ASPH Antibody

See related secondary antibodies

Search for all "ASPH"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat ASPH

Product Description for ASPH

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat ASPH.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ASPH

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ASP beta-hydroxylase, Aspartate beta-hydroxylase, Aspartyl/asparaginyl beta-hydroxylase, HAAH, JCTN, Peptide-aspartate beta-dioxygenase, junctin
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q12797
Immunogen:
The immunogen for Anti-ASPH Antibody: synthetic peptide directed towards the middle region of human ASPH. Synthetic peptide located within the following region: ETNRKTDDPEQKAKVKKKKPKLLNKFDKTIKAELDAAEKLRKRGKIEEAV.
GeneID:
444
Application WB
Background ASPH is thought to play an important role in calcium homeostasis. Altertive splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ASPH (12 products)

Catalog No. Species Pres. Purity   Source  

ASPH (transcript variant 3)

ASPH Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ASPH (transcript variant 1)

ASPH Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ASPH (transcript variant 2)

ASPH Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ASPH (transcript variant 11)

ASPH Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ASPH (75-270, His-tag)

ASPH Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €1,070.00
  OriGene Technologies GmbH

ASPH (75-270, His-tag)

ASPH Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €400.00
  OriGene Technologies GmbH

ASPH

ASPH Human
  Abnova Taiwan Corp.

ASPH

ASPH Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ASPH

ASPH Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ASPH

ASPH Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ASPH

ASPH Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ASPH

SDS-Page: Aspartate beta hydroxylase Protein [NBP1-40403] - ASPH, 24.5 kDa (217aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE Liquid
  Novus Biologicals Inc.

Positive controls for ASPH (4 products)

Catalog No. Species Pres. Purity   Source  

Aspartate beta hydroxylase Lysate

Western Blot: Aspartate beta hydroxylase Lysate [NBL1-07773] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ASPH Protein
  Novus Biologicals Inc.

ASPH 293T Cell Transient Overexpression Lysate(Denatured)

ASPH 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ASPH Lysate(Denatured)

ASPH Lysate(Denatured)
  Abnova Taiwan Corp.

ASPH overexpression lysate

ASPH overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn