TA335761 Timeless (Tim) antibody

Rabbit Polyclonal Anti-TIMELESS Antibody

See related secondary antibodies

Search for all "Timeless (Tim)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Sheep Timeless (Tim)

TA335761

More Views

  • TA335761

Product Description for Timeless (Tim)

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Sheep Timeless (Tim).
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Timeless (Tim)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Protein timeless homolog, Tim1, Timeless1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt, Sh
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UNS1
Immunogen:
The immunogen for Anti-TIMELESS Antibody: synthetic peptide directed towards the N terminal of human TIMELESS. Synthetic peptide located within the following region: IGERDLIFHKGLHNLRNYSSDLGKQPKKVPKRRQAARELSIQRRSALNVR.
GeneID:
8914
Application WB
IHC
Background The human Timeless protein interacts with both the circadian clock protein cryptochrome 2 and with the cell cycle checkpoint proteins Chk1 and the ATR-ATRIP complex and plays an important role in the D damage checkpoint response. Down-regulation of Timeless in human cells seriously compromises replication and intra-S checkpoints, indicating an intimate connection between the circadian cycle and the D damage checkpoints that is in part mediated by the Timeless protein.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Timeless (Tim) (1 products)

Catalog No. Species Pres. Purity   Source  

Timeless (Tim)

Timeless (Tim) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

Positive controls for Timeless (Tim) (3 products)

Catalog No. Species Pres. Purity   Source  

TIMELESS 293T Cell Transient Overexpression Lysate(Denatured)

TIMELESS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Timeless Lysate

Western Blot: Timeless Lysate [NBL1-16915] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TIMELESS
  Novus Biologicals Inc.

TIMELESS overexpression lysate

TIMELESS overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn