TA335762 ADAM7 / GP83 antibody

Rabbit Polyclonal Anti-ADAM7 Antibody

See related secondary antibodies

Search for all "ADAM7 / GP83"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse ADAM7 / GP83

Product Description for ADAM7 / GP83

Rabbit anti Canine, Human, Mouse ADAM7 / GP83.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ADAM7 / GP83

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Disintegrin and metalloproteinase domain-containing protein 7
Presentation Aff - Purified
Reactivity Can, Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H2U9
Immunogen:
Synthetic peptide directed towards the C terminal of human ADAM7
AA Sequence:
PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK
GeneID:
8756
Application Western blotting (0.2 - 1.0 µg/ml)
Background The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response. ADAM7 may play an important role in male reproduction including sperm maturation and gonadotrope function. This is a non catalytic metalloprotease-like protein.
General Readings "Analysis of the disintegrin-metalloproteinases family reveals ADAM29 and ADAM7 are often mutated in melanoma." Wei X., Moncada-Pazos A., Cal S., Soria-Valles C., Gartner J., Rudloff U., Lin J.C., Rosenberg S.A., Lopez-Otin C., Samuels Y. Hum. Mutat. 32:E2148-E2175(2011)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Dog
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for ADAM7 / GP83 (2 products)

Catalog No. Species Pres. Purity   Source  

ADAM7 / GP83

ADAM7 / GP83 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ADAM7 / GP83

ADAM7 / GP83 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ADAM7 / GP83 (1 products)

Catalog No. Species Pres. Purity   Source  

ADAM7 293T Cell Transient Overexpression Lysate(Denatured)

ADAM7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn