TA335765 Pyridoxal kinase / PDXK antibody

Rabbit Polyclonal Anti-PDXK Antibody

See related secondary antibodies

Search for all "Pyridoxal kinase / PDXK"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Pyridoxal kinase / PDXK

Product Description for Pyridoxal kinase / PDXK

Rabbit anti Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Pyridoxal kinase / PDXK.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Pyridoxal kinase / PDXK

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C21orf124, C21orf97, PKH, PNK, PRED79, Pyridoxine kinase
Presentation Purified
Reactivity GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00764
Immunogen:
The immunogen for Anti-PDXK Antibody: synthetic peptide directed towards the middle region of human PDXK. Synthetic peptide located within the following region: RKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRN.
GeneID:
8566
Application WB
Background PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer. The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Altertively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Pyridoxal kinase / PDXK (12 products)

Catalog No. Species Pres. Purity   Source  

Pyridoxal kinase / PDXK

Pyridoxal kinase / PDXK Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Pyridoxal kinase / PDXK (1-312, His-tag)

Pyridoxal kinase / PDXK Human Purified > 90 % E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

Pyridoxal kinase / PDXK (1-312, His-tag)

Pyridoxal kinase / PDXK Human Purified > 90 % E. coli
50 µg / €400.00
  OriGene Technologies GmbH

Pyridoxal kinase / PDXK

Pyridoxal kinase / PDXK Human in vitro transl.
  Abnova Taiwan Corp.

Pyridoxal kinase / PDXK

Pyridoxal kinase / PDXK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Pyridoxal kinase / PDXK

Pyridoxal kinase / PDXK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Pyridoxal kinase / PDXK

Pyridoxal kinase / PDXK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Pyridoxal kinase / PDXK

Pyridoxal kinase / PDXK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Pyridoxal kinase / PDXK

Pyridoxal kinase / PDXK Human
  Abnova Taiwan Corp.

Pyridoxal kinase / PDXK

Pyridoxal kinase / PDXK Human
  Abnova Taiwan Corp.

Pyridoxal kinase / PDXK

Pyridoxal kinase / PDXK Human Purified
  Novus Biologicals Inc.

Pyridoxal kinase / PDXK

Pyridoxal kinase / PDXK Human Purified
  Novus Biologicals Inc.

Positive controls for Pyridoxal kinase / PDXK (2 products)

Catalog No. Species Pres. Purity   Source  

PDXK 293T Cell Transient Overexpression Lysate(Denatured)

PDXK 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PDXK Lysate

Western Blot: PDXK Lysate [NBL1-14267] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PDXK
  Novus Biologicals Inc.
  • LinkedIn