TA335767 ULK1 / ATG1 antibody

Rabbit Polyclonal Anti-ULK1 Antibody

See related secondary antibodies

Search for all "ULK1 / ATG1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rat, Zebrafish ULK1 / ATG1

Product Description for ULK1 / ATG1

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rat, Zebrafish ULK1 / ATG1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ULK1 / ATG1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Autophagy-related protein 1 homolog, KIAA0722, Serine/threonine-protein kinase ULK1, Unc-51-like kinase 1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75385
Immunogen:
The immunogen for Anti-ULK1 Antibody is: synthetic peptide directed towards the N-terminal region of Human ULK1. Synthetic peptide located within the following region: PEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTL.
GeneID:
8408
Application WB
Background ULK1 is a serine/threonine-protein kise involved in autophagy in response to starvation. It acts upstream of phosphatidylinositol 3-kise PIK3C3 to regulate the formation of autophagophores, the precursors of autophagosomes. Part of regulatory feedback loops in autophagy: acts both as a downstream effector and negative regulator of mammalian target of rapamycin complex 1 (mTORC1) via interaction with RPTOR. It is activated via phosphorylation by AMPK and also acts as a regulator of AMPK by mediating phosphorylation of AMPK subunits PRKAA1, PRKAB2 and PRKAG1, leading to negatively regulate AMPK activity. It may phosphorylate ATG13/KIAA0652 and RPTOR; however such data need additiol evidences and plays a role early in neurol differentiation and is required for granule cell axon formation.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ULK1 / ATG1 (5 products)

Catalog No. Species Pres. Purity   Source  

ULK1 / ATG1

ULK1 / ATG1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

ULK1 / ATG1

ULK1 / ATG1 Human Purified
  Abnova Taiwan Corp.

ULK1 / ATG1

ULK1 / ATG1 Human Purified
  Abnova Taiwan Corp.

ULK1 / ATG1

ULK1 / ATG1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ULK1 / ATG1

ULK1 / ATG1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ULK1 / ATG1 (2 products)

Catalog No. Species Pres. Purity   Source  

ULK1 Lysate

Western Blot: ULK1 Lysate [NBL1-17607] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ULK1
  Novus Biologicals Inc.

ULK1 overexpression lysate

ULK1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn