TA335776 Zyxin antibody

Rabbit Polyclonal Anti-ZYX Antibody

See related secondary antibodies

Search for all "Zyxin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat Zyxin

Product Description for Zyxin

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat Zyxin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Zyxin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ZYX, Zyxin-2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15942
Immunogen:
The immunogen for Anti-ZYX Antibody: synthetic peptide directed towards the middle region of human ZYX. Synthetic peptide located within the following region: QPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPE.
GeneID:
7791
Application WB
Background TRIM50 is an E3 ubiquitin-protein ligase.Focal adhesions are actin-rich structures that eble cells to adhere to the extracellular matrix and at which protein complexes involved in sigl transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-termil proline-rich domain and three LIM domains in its C-termil half. The proline-rich domain may interact with SH3 domains of proteins involved in sigl transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the sigl transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles. Altertive splicing results in multiple transcript variants that encode the same isoform.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Zyxin (4 products)

Catalog No. Species Pres. Purity   Source  

Zyxin (transcript variant 2)

Zyxin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Zyxin (transcript variant 1)

Zyxin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Zyxin

Zyxin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Zyxin

Zyxin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Zyxin (2 products)

Catalog No. Species Pres. Purity   Source  

ZYX 293T Cell Transient Overexpression Lysate(Denatured)

ZYX 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Zyxin Lysate

Western Blot: Zyxin Lysate [NBL1-18278] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ZYX.
  Novus Biologicals Inc.
  • LinkedIn