TA335778 TRIM26 / RNF95 antibody

Rabbit Polyclonal Anti-TRIM26 Antibody

See related secondary antibodies

Search for all "TRIM26 / RNF95"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TRIM26 / RNF95

Product Description for TRIM26 / RNF95

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TRIM26 / RNF95.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIM26 / RNF95

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acid finger protein, RING finger protein 95, Tripartite motif-containing protein 26, ZNF173, Zinc finger protein 173
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q12899
Immunogen:
The immunogen for Anti-TRIM26 Antibody: synthetic peptide directed towards the N terminal of human TRIM26. Synthetic peptide located within the following region: NHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLR.
GeneID:
7726
Application WB
Background TRIM26 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Although the function of the protein is unknown, the RING domain suggests that the protein may have D-binding activity.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIM26 / RNF95 (6 products)

Catalog No. Species Pres. Purity   Source  

TRIM26 / RNF95

TRIM26 / RNF95 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TRIM26 / RNF95

TRIM26 / RNF95 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIM26 / RNF95

TRIM26 / RNF95 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIM26 / RNF95

TRIM26 / RNF95 Human Purified
  Abnova Taiwan Corp.

TRIM26 / RNF95

TRIM26 / RNF95 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TRIM26 / RNF95

TRIM26 / RNF95 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TRIM26 / RNF95 (2 products)

Catalog No. Species Pres. Purity   Source  

TRIM26 293T Cell Transient Overexpression Lysate(Denatured)

TRIM26 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TRIM26 Lysate

Western Blot: TRIM26 Lysate [NBL1-17286] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TRIM26
  Novus Biologicals Inc.
  • LinkedIn