TA335779 TNP1 antibody

Rabbit Polyclonal Anti-TNP1 Antibody

See related secondary antibodies

Search for all "TNP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TNP1

Product Description for TNP1

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TNP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TNP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms STP-1, Spermatid nuclear transition protein 1
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P09430
Immunogen:
The immunogen for Anti-TNP1 Antibody: synthetic peptide directed towards the N terminal of human TNP1. Synthetic peptide located within the following region: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN.
GeneID:
7141
Application WB
Background TNP1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines.Transition protein-1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines (see PRM1, MIM 182880; PRM2, MIM 182890) (Luerssen et al., 1990 [PubMed 2249851]).[supplied by OMIM]. Sequence Note: removed 4 bases from the 5' end that did not align to the reference genome assembly. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TNP1 (4 products)

Catalog No. Species Pres. Purity   Source  

TNP1

TNP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TNP1

TNP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TNP1

TNP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TNP1

TNP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn