SS-A / Ro52 / TRIM21 - TA335783 | acris-antibodies.com

Product Description for SS-A / Ro52 / TRIM21

Rabbit anti Bovine, Equine, Human, Porcine, Rat, Zebrafish SS-A / Ro52 / TRIM21.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SS-A / Ro52 / TRIM21

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	E3 ubiquitin-protein ligase TRIM21, RING finger protein 81, RNF81, Ro(SS-A), SSA1, Sjoegren syndrome type A antigen, TRIM21, Tripartite motif-containing protein 21
Presentation	Purified
Reactivity	Bov, Eq, Hu, Por, Rt, Ze
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: P19474 Immunogen: The immunogen for Anti-TRIM21 Antibody: synthetic peptide directed towards the C terminal of human TRIM21. Synthetic peptide located within the following region: YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQ. GeneID: 6737
Application	WB
Background	TRIM21 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM21 is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small R molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus.This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small R molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Altertively spliced transcript variants for this gene have been described but the full-length ture of only one has been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format	Purification: Protein A purified Buffer System: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SS-A / Ro52 / TRIM21 (13 products)

Catalog No.	Species	Pres.	Purity	Source
TP302088	SS-A / Ro52 / TRIM21
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
AR10296PU-L	SS-A / Ro52 / TRIM21
	Human	Purified	> 90.0% as determined by both RP-HPLC and SDS-PAGE analysis	E. coli
					OriGene Technologies GmbH
AR10296PU-N	SS-A / Ro52 / TRIM21
	Human	Purified	> 90.0% as determined by both RP-HPLC and SDS-PAGE analysis	E. coli
					OriGene Technologies GmbH
AR10296PU-S	SS-A / Ro52 / TRIM21
	Human	Purified	> 90.0% as determined by both RP-HPLC and SDS-PAGE analysis	E. coli
					OriGene Technologies GmbH
PA1338	SS-A / Ro52 / TRIM21
	Human	Purified	> 90 % pure as determined by both: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.	E. coli
					OriGene Technologies GmbH
PA1338X	SS-A / Ro52 / TRIM21
	Human	Purified	> 90 % pure as determined by both: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.	E. coli
					OriGene Technologies GmbH
PA1338XC	SS-A / Ro52 / TRIM21
	Human	Purified	> 90 % pure as determined by both: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.	E. coli
					OriGene Technologies GmbH
H00006737-P01-02	SS-A / Ro52 / TRIM21
	Human			in vitro transl.
					Abnova Taiwan Corp.
H00006737-P01-10	SS-A / Ro52 / TRIM21
	Human			in vitro transl.
					Abnova Taiwan Corp.
H00006737-P01-25	SS-A / Ro52 / TRIM21
	Human			in vitro transl.
					Abnova Taiwan Corp.
H00006737-Q01-10	SS-A / Ro52 / TRIM21
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00006737-Q01-25	SS-A / Ro52 / TRIM21
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
P308-3	SS-A / Ro52 / TRIM21
	Human	Purified	> 96 %	Insect cells
					BBI Solutions

Positive controls for SS-A / Ro52 / TRIM21 (3 products)

Catalog No.	Species
NBL1-17281	SSA1 Lysate

		Novus Biologicals Inc.
LY401090	TRIM21 overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.
H00006737-T01	TRIM21 / RNF81

		Abnova Taiwan Corp.

Recommended Secondary Antibodies for SS-A / Ro52 / TRIM21 (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH