TA335785 SPI1 / PU.1 antibody

Rabbit Polyclonal Anti-SPI1 Antibody

See related secondary antibodies

Search for all "SPI1 / PU.1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Zebrafish SPI1 / PU.1

Product Description for SPI1 / PU.1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Zebrafish SPI1 / PU.1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SPI1 / PU.1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 31 kDa transforming protein, SFPI1, SPI-1 proto-oncogene, Transcription factor PU.1, spleen focus forming virus (SFFV) proviral integration oncogene spi1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P17947
Immunogen:
The immunogen for Anti-SPI1 Antibody: synthetic peptide directed towards the middle region of human SPI1. Synthetic peptide located within the following region: QKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAER.
GeneID:
6688
Application WB
Background SPI1 is known to collaborate with multiple transcription factors and to regulate expression of immunoglobulin genes. Lack of SPI1 expression is associated with defective immunoglobulin transcription in Hodgkin and Reed-Sternberg cells of classical Hodgkin disease. This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordition with other transcription factors and cofactors. The protein can also regulate altertive splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SPI1 / PU.1 (8 products)

Catalog No. Species Pres. Purity   Source  

SPI1 / PU.1 (full length, N-term HIS tag, transcript variant 2)

SPI1 / PU.1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

SPI1 / PU.1 (N-term HIS tag, transcript variant 1)

SPI1 / PU.1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

SPI1 / PU.1 (1-271, His-tag)

SPI1 / PU.1 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

SPI1 / PU.1 (1-271, His-tag)

SPI1 / PU.1 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

SPI1 / PU.1

SPI1 / PU.1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SPI1 / PU.1

SPI1 / PU.1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SPI1 / PU.1

SPI1 / PU.1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SPI1 / PU.1

SPI1 / PU.1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SPI1 / PU.1 (2 products)

Catalog No. Species Pres. Purity   Source  

SPI1 overexpression lysate

SPI1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SPI1 overexpression lysate

SPI1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn