TA335788 SOX11 antibody

Rabbit Polyclonal Anti-SOX11 Antibody

See related secondary antibodies

Search for all "SOX11"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SOX11

Product Description for SOX11

Rabbit anti Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SOX11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SOX11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SRY-box 11, Transcription factor SOX-11
Presentation Purified
Reactivity Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P35716
Immunogen:
The immunogen for Anti-SOX11 Antibody: synthetic peptide directed towards the N terminal of human SOX11. Synthetic peptide located within the following region: MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIK.
GeneID:
6664
Application WB
Background SOX11 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determition of the cell fate. The protein may act as a transcriptiol regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis.This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determition of the cell fate. The encoded protein may act as a transcriptiol regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SOX11 (2 products)

Catalog No. Species Pres. Purity   Source  

SOX11 Lysate

Western Blot: SOX11 Lysate [NBL1-16345] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SOX11
  Novus Biologicals Inc.

SOX11 overexpression lysate

SOX11 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn