TA335790 SMARCE1 / BAF57 antibody

Rabbit Polyclonal Anti-SMARCE1 Antibody

See related secondary antibodies

Search for all "SMARCE1 / BAF57"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Zebrafish SMARCE1 / BAF57

TA335790

More Views

  • TA335790
  • TA335790
  • TA335790

Product Description for SMARCE1 / BAF57

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Zebrafish SMARCE1 / BAF57.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SMARCE1 / BAF57

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BRG1-associated factor 57, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q969G3
Immunogen:
The immunogen for Anti-SMARCE1 Antibody: synthetic peptide directed towards the N terminal of human SMARCE1. Synthetic peptide located within the following region: MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSR.
GeneID:
6605
Application WB
IHC
Background SMARCE1 is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptiol activation of genes normally repressed by chromatin. The protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction D, which is thought to mimic the topology of D as it enters or exits the nucleosome. The protein contains a D-binding HMG domain, but disruption of this domain does not abolish the D-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart.The protein encoded by this gene is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptiol activation of genes normally repressed by chromatin. The encoded protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction D, which is thought to mimic the topology of D as it enters or exits the nucleosome. The protein contains a D-binding HMG domain, but disruption of this domain does not abolish the D-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SMARCE1 / BAF57 (5 products)

Catalog No. Species Pres. Purity   Source  

SMARCE1 / BAF57

SMARCE1 / BAF57 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SMARCE1 / BAF57

SMARCE1 / BAF57 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SMARCE1 / BAF57

SMARCE1 / BAF57 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SMARCE1 / BAF57

SMARCE1 / BAF57 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SMARCE1 / BAF57

SMARCE1 / BAF57 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SMARCE1 / BAF57 (2 products)

Catalog No. Species Pres. Purity   Source  

BAF57 Lysate

Western Blot: BAF57 Lysate [NBL1-16235] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SMARCE1
  Novus Biologicals Inc.

SMARCE1 293T Cell Transient Overexpression Lysate(Denatured)

SMARCE1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn