TA335797 RING1 / RNF1 antibody

Rabbit Polyclonal Anti-RING1 Antibody

See related secondary antibodies

Search for all "RING1 / RNF1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat RING1 / RNF1

Product Description for RING1 / RNF1

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat RING1 / RNF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RING1 / RNF1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms E3 ubiquitin-protein ligase RING1, Polycomb complex protein RING1, RING finger protein 1, Really interesting new gene 1 protein
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q06587
Immunogen:
The immunogen for Anti-RING1 Antibody: synthetic peptide directed towards the N terminal of human RING1. Synthetic peptide located within the following region: MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPI.
GeneID:
6015
Application WB
Background RING1 can bind D and can act as a transcriptiol repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in la
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RING1 / RNF1 (5 products)

Catalog No. Species Pres. Purity   Source  

RING1 / RNF1

RING1 / RNF1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RING1 / RNF1

RING1 / RNF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RING1 / RNF1

RING1 / RNF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RING1 / RNF1

RING1 / RNF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RING1 / RNF1

RING1 / RNF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RING1 / RNF1 (3 products)

Catalog No. Species Pres. Purity   Source  

RING1 293T Cell Transient Overexpression Lysate(Denatured)

RING1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RING1 Lysate

Western Blot: RING1 Lysate [NBL1-15372] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for RING1
  Novus Biologicals Inc.

RING1 overexpression lysate

RING1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn