TA335803 PSMC5 / SUG1 antibody

Rabbit Polyclonal Anti-PSMC5 Antibody

See related secondary antibodies

Search for all "PSMC5 / SUG1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat PSMC5 / SUG1

TA335803

More Views

  • TA335803
  • TA335803
  • TA335803

Product Description for PSMC5 / SUG1

Rabbit anti Bovine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat PSMC5 / SUG1.
Presentation: Purified
Product is tested for Immunoprecipitation, Paraffin Sections, Western blot / Immunoblot.

Properties for PSMC5 / SUG1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 26S protease regulatory subunit 8, Proteasome subunit p45, SUG-1, TBP10, TRIP1, Thyroid hormone receptor-interacting protein 1, p45/SUG
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Por, Rb, Rt
Applications IP, P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P62195
Immunogen:
The immunogen for Anti-PSMC5 Antibody: synthetic peptide directed towards the C terminal of human PSMC5. Synthetic peptide located within the following region: AEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK.
GeneID:
5705
Application WB
IHC
IP
Background The 26S proteasome is a multicatalytic proteise complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits.PSMC5 is one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. In addition to participation in proteasome functions, this subunit may participate in transcriptiol regulation since it has been shown to interact with the thyroid hormone receptor and retinoid X receptor-alpha.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PSMC5 / SUG1 (3 products)

Catalog No. Species Pres. Purity   Source  

PSMC5 / SUG1

PSMC5 / SUG1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PSMC5 / SUG1

PSMC5 / SUG1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PSMC5 / SUG1

PSMC5 / SUG1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for PSMC5 / SUG1 (1 products)

Catalog No. Species Pres. Purity   Source  

PSMC5 Lysate

Western Blot: PSMC5 Lysate [NBL1-14892] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PSMC5
  Novus Biologicals Inc.
  • LinkedIn