TA335810 PLAG1 antibody

Rabbit Polyclonal Anti-PLAG1 Antibody

See related secondary antibodies

Search for all "PLAG1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat PLAG1

TA335810

More Views

  • TA335810
  • TA335810

Product Description for PLAG1

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat PLAG1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PLAG1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Pleiomorphic adenoma gene 1 protein, Zinc finger protein PLAG1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6DJT9
Immunogen:
The immunogen for Anti-PLAG1 Antibody: synthetic peptide directed towards the N terminal of human PLAG1. Synthetic peptide located within the following region: MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLK.
GeneID:
5324
Application WB
Background PLAG1 is a zinc finger protein with 2 putative nuclear localization sigls. PLAG1, which is developmentally regulated, has been shown to be consistently rearranged in pleomorphic adenomas of the salivary glands. PLAG1 is activated by the reciprocal chromosomal translocations involving 8q12 in a subset of salivary gland pleomorphic adenomas.Pleomorphic adenoma gene 1 encodes a zinc finger protein with 2 putative nuclear localization sigls. PLAG1, which is developmentally regulated, has been shown to be consistently rearranged in pleomorphic adenomas of the salivary glands. PLAG1 is activated by the reciprocal chromosomal translocations involving 8q12 in a subset of salivary gland pleomorphic adenomas. Three transcript variants encoding two different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PLAG1 (2 products)

Catalog No. Species Pres. Purity   Source  

PLAG1

PLAG1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PLAG1

PLAG1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PLAG1 (2 products)

Catalog No. Species Pres. Purity   Source  

PLAG1 Lysate

Western Blot: PLAG1 Lysate [NBL1-14483] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PLAG1
  Novus Biologicals Inc.

PLAG1 overexpression lysate

PLAG1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn