TA335819 GPNMB / HGFIN antibody

Rabbit Polyclonal Anti-GPNMB Antibody

See related secondary antibodies

Search for all "GPNMB / HGFIN"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat GPNMB / HGFIN

TA335819

More Views

  • TA335819

Product Description for GPNMB / HGFIN

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat GPNMB / HGFIN.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for GPNMB / HGFIN

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Transmembrane glycoprotein HGFIN, Transmembrane glycoprotein NMB
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14956
Immunogen:
The immunogen for Anti-GPNMB Antibody: synthetic peptide directed towards the N terminal of human GPNMB. Synthetic peptide located within the following region: KGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNE.
GeneID:
10457
Application WB
IHC
Background GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GPNMB / HGFIN (9 products)

Catalog No. Species Pres. Purity   Source  

GPNMB / HGFIN (transcript variant 1)

GPNMB / HGFIN Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GPNMB / HGFIN (transcript variant 1)

GPNMB / HGFIN Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

GPNMB / HGFIN (22-474, His-tag)

GPNMB / HGFIN Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

GPNMB / HGFIN (22-474, His-tag)

GPNMB / HGFIN Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

GPNMB / HGFIN

GPNMB / HGFIN Human in vitro transl.
  Abnova Taiwan Corp.

GPNMB / HGFIN

GPNMB / HGFIN Human in vitro transl.
  Abnova Taiwan Corp.

GPNMB / HGFIN

GPNMB / HGFIN Human in vitro transl.
  Abnova Taiwan Corp.

GPNMB / HGFIN

GPNMB / HGFIN Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GPNMB / HGFIN

GPNMB / HGFIN Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GPNMB / HGFIN (2 products)

Catalog No. Species Pres. Purity   Source  

GPNMB Lysate

Western Blot: GPNMB Lysate [NBL1-11239] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GPNMB
  Novus Biologicals Inc.

GPNMB overexpression lysate

GPNMB overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn