TA335820 NKX2-2 antibody

Rabbit Polyclonal Anti-NKX2-2 Antibody

See related secondary antibodies

Search for all "NKX2-2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rat, Zebrafish NKX2-2

TA335820

More Views

  • TA335820

Product Description for NKX2-2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rat, Zebrafish NKX2-2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NKX2-2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein Nkx-2.2, NK2 transcription factor related, NKX2.2, NKX2B, locus 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95096
Immunogen:
The immunogen for Anti-NKX2-2 Antibody: synthetic peptide directed towards the N terminal of human NKX2-2. Synthetic peptide located within the following region: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQ.
GeneID:
4821
Application WB
Background Nkx2-2 contains 1 homeobox D-binding domain which is essential for interaction with OLIG2. Nkx2-2 may be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axol guidance. The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NKX2-2 (3 products)

Catalog No. Species Pres. Purity   Source  

NKX2-2 (full length, N-term HIS tag)

NKX2-2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

NKX2-2

NKX2-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NKX2-2

NKX2-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NKX2-2 (2 products)

Catalog No. Species Pres. Purity   Source  

Nkx2.2 Lysate

Western Blot: Nkx2.2 Lysate [NBL1-13661] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NKX2
  Novus Biologicals Inc.

NKX2 overexpression lysate

NKX2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn