TA335823 NFKBIB / IKBB antibody

Rabbit Polyclonal Anti-NFKBIB Antibody

See related secondary antibodies

Search for all "NFKBIB / IKBB"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat NFKBIB / IKBB

TA335823

More Views

  • TA335823

Product Description for NFKBIB / IKBB

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat NFKBIB / IKBB.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for NFKBIB / IKBB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms I-kappa-B-beta, IkB-B, IkB-beta, IkappaBbeta, NF-kappa-B inhibitor beta, TR-interacting protein 9, TRIP9, Thyroid receptor-interacting protein 9
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15653
Immunogen:
The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the C terminal of human NFKBIB. Synthetic peptide located within the following region: MLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVV.
GeneID:
4793
Application WB
IHC
Background NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB), which ictivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kises (IKBKA, MIM 600664 or IKBKB, MIM 603258) marks them for destruction via the ubiquitition pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds D at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM].NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB), which ictivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kises (IKBKA, MIM 600664 or IKBKB, MIM 603258) marks them for destruction via the ubiquitition pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds D at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM].
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NFKBIB / IKBB (10 products)

Catalog No. Species Pres. Purity   Source  

NFKBIB / IKBB (transcript variant 1)

NFKBIB / IKBB Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NFKBIB / IKBB (1-356, His-tag)

NFKBIB / IKBB Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

NFKBIB / IKBB (1-356, His-tag)

NFKBIB / IKBB Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

NFKBIB / IKBB

NFKBIB / IKBB Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NFKBIB / IKBB

NFKBIB / IKBB Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NFKBIB / IKBB

NFKBIB / IKBB Human Purified
  Abnova Taiwan Corp.

NFKBIB / IKBB

NFKBIB / IKBB Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NFKBIB / IKBB

NFKBIB / IKBB Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NFKBIB / IKBB

NFKBIB / IKBB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NFKBIB / IKBB

NFKBIB / IKBB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NFKBIB / IKBB (3 products)

Catalog No. Species Pres. Purity   Source  

I Kappa B beta (IKBb)

I Kappa B beta (IKBb)
  Abnova Taiwan Corp.

IkB beta Lysate

Western Blot: IkB beta Lysate [NBL1-13621] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NFKBIB
  Novus Biologicals Inc.

NFKBIB overexpression lysate

NFKBIB overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn