TA335827 IRF4 antibody

Rabbit Polyclonal Anti-IRF4 Antibody

See related secondary antibodies

Search for all "IRF4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat IRF4

TA335827

More Views

  • TA335827

Product Description for IRF4

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat IRF4.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for IRF4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Interferon regulatory factor 4, LSIRF, Lymphocyte-specific interferon regulatory factor, MUM1, Multiple myeloma oncogene 1, NF-EM5
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15306
Immunogen:
The immunogen for Anti-IRF4 Antibody: synthetic peptide directed towards the N terminal of human IRF4. Synthetic peptide located within the following region: MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIF.
GeneID:
3662
Application WB
IHC
Background IFN regulatory factor (IRF)-4 is a lymphoid/myeloid-restricted member of the IRF transcription factor family that plays an essential role in the homeostasis and function of mature lymphocytes. IRF-4 expression is tightly regulated in resting primary T cells and is transiently induced at the mR and protein levels after activation by Ag-mimetic stimuli such as TCR cross-linking or treatment with phorbol ester and calcium ionophore (PMA/ionomycin).
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IRF4 (8 products)

Catalog No. Species Pres. Purity   Source  

IRF4

IRF4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

IRF4

IRF4 Human Purified E. coli
  OriGene Technologies GmbH

IRF4

IRF4 Human Purified E. coli
  OriGene Technologies GmbH

IRF4

IRF4 Human Purified E. coli
  OriGene Technologies GmbH

IRF4

IRF4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IRF4

IRF4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IRF4

IRF4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IRF4

IRF4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for IRF4 (1 products)

Catalog No. Species Pres. Purity   Source  

IRF4 Lysate

Western Blot: IRF4 Lysate [NBL1-12033] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IRF4
  Novus Biologicals Inc.
  • LinkedIn