TA335830 MNDA antibody

Rabbit Polyclonal Anti-MNDA Antibody

See related secondary antibodies

Search for all "MNDA"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MNDA

Product Description for MNDA

Rabbit anti Human MNDA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MNDA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Myeloid cell nuclear differentiation antigen
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P41218
Immunogen:
The immunogen for Anti-MNDA Antibody: synthetic peptide directed towards the C terminal of human MNDA. Synthetic peptide located within the following region: KCEKGDKLRLFCLQLRTVDRKLKLVCGSHSFIKVIKAKKNKEGPMNVN.
GeneID:
4332
Application WB
Background The myeloid cell nuclear differentiation antigen (MNDA) is detected only in nuclei of cells of the granulocyte-monocyte lineage.MNDA may act as a transcriptiol activator/repressor in the myeloid lineage. It plays a role in the granulocyte/monocyte cell-specific response to interferon. MNDA stimulates the D binding of the transcriptiol repressor protein YY1.The myeloid cell nuclear differentiation antigen (MNDA) is detected only in nuclei of cells of the granulocyte-monocyte lineage. A 200-amino acid region of human MNDA is strikingly similar to a region in the proteins encoded by a family of interferon-inducible mouse genes, desigted Ifi-201, Ifi-202, and Ifi-203, that are not regulated in a cell- or tissue-specific fashion. The 1.8-kb MNDA mR, which contains an interferon-stimulated response element in the 5-prime untranslated region, was significantly upregulated in human monocytes exposed to interferon alpha. MNDA is located within 2,200 kb of FCER1A, APCS, CRP, and SPTA1. In its pattern of expression and/or regulation, MNDA resembles IFI16, suggesting that these genes participate in blood cell-specific responses to interferons. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MNDA (8 products)

Catalog No. Species Pres. Purity   Source  

MNDA

MNDA Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MNDA (1-407, His-tag)

MNDA Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €1,570.00
  OriGene Technologies GmbH

MNDA (1-407, His-tag)

MNDA Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €570.00
  OriGene Technologies GmbH

MNDA

MNDA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MNDA

MNDA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MNDA

MNDA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MNDA

MNDA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MNDA

SDS-Page: MNDA Protein [NBP1-30314] - MNDA, 47.9 kDa (427aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE
  Novus Biologicals Inc.

Positive controls for MNDA (2 products)

Catalog No. Species Pres. Purity   Source  

MNDA 293T Cell Transient Overexpression Lysate(Denatured)

MNDA 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MNDA Lysate

Western Blot: MNDA Lysate [NBL1-13165] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MNDA
  Novus Biologicals Inc.
  • LinkedIn