TA335832 MLN antibody

Rabbit Polyclonal Anti-MLN Antibody

See related secondary antibodies

Search for all "MLN"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Sheep MLN

Product Description for MLN

Rabbit anti Human, Sheep MLN.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MLN

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MAP, Motilin, Motilin-associated peptide, Promotilin
Presentation Purified
Reactivity Hu, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P12872
Immunogen:
The immunogen for Anti-MLN Antibody: synthetic peptide directed towards the middle region of human MLN. Synthetic peptide located within the following region: LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLE.
GeneID:
4295
Application WB
Background This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestil contractions and motility. Proteolytic processing of the secreted protein produces the mature peptide and a byproduct referred to as mo
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MLN (4 products)

Catalog No. Species Pres. Purity   Source  

MLN (transcript variant 1)

MLN Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MLN (transcript variant 2)

MLN Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

MLN

MLN Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MLN

MLN Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for MLN (1 products)

Catalog No. Species Pres. Purity   Source  

MLN overexpression lysate

MLN overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn