TA335836 MAZ antibody

Rabbit Polyclonal Anti-MAZ Antibody

See related secondary antibodies

Search for all "MAZ"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Porcine, Rat MAZ

TA335836

More Views

  • TA335836

Product Description for MAZ

Rabbit anti Human, Mouse, Porcine, Rat MAZ.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for MAZ

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Myc-associated zinc finger protein, Pur-1, Purine-binding transcription factor, SAF-1
Presentation Purified
Reactivity Hu, Ms, Por, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P56270
Immunogen:
The immunogen for Anti-MAZ Antibody: synthetic peptide directed towards the N terminal of human MAZ. Synthetic peptide located within the following region: FPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSR.
GeneID:
4150
Application WB
IHC
Background MAZ may function as a transcription factor with dual roles in transcription initiation and termition.It binds to two sites, ME1a1 and ME1a2, within the c-myc promoter having greater affinity for the former. It also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MAZ (5 products)

Catalog No. Species Pres. Purity   Source  

MAZ (transcript variant 1)

MAZ Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MAZ

MAZ Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MAZ

MAZ Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MAZ

MAZ Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MAZ

MAZ Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MAZ (2 products)

Catalog No. Species Pres. Purity   Source  

MAZ overexpression lysate

MAZ overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

MAZ overexpression lysate

MAZ overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn