TA335844 Jun-B antibody

Rabbit Polyclonal Anti-JUNB Antibody

See related secondary antibodies

Search for all "Jun-B"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat Jun-B

Product Description for Jun-B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat Jun-B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Jun-B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms JUNB, Transcription factor jun-B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P17275
Immunogen:
The immunogen for Anti-JUNB Antibody: synthetic peptide directed towards the N terminal of human JUNB. Synthetic peptide located within the following region: YGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYF.
GeneID:
3726
Application WB
Background The c-Jun proto-oncogene was first identified as the cellular homolog of the avian sarcoma virus v-Jun oncogene. The c-Jun protein, along with c-Fos, is a component of the AP-1 transcriptiol complex. c-Jun can form either Jun/Jun homodimers or Jun/Fos heterodimers via the leucine repeats in both proteins. Jun B and Jun D, have been shown to be almost identical to c-Jun in their C-termil regions, which are involved in dimerization and D binding, whereas their N-termil domains, which are involved in transcriptiol activation, diverge. JunB is involved in many types of human carcinoma including T-cell lymphomas, CML,primary cutaneous lymphomas. Aberrantly expressed c-Jun and JunB are a hallmark of Hodgkin lymphoma cells, stimulate proliferation and synergize with NF-kappa B. JunB potentiates function of BRCA1 activation domain 1 (AD1) through a coiled-coil-mediated interaction.JunB is an important regulator of erythroid Differentiation.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Jun-B (5 products)

Catalog No. Species Pres. Purity   Source  

Jun-B

Jun-B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Jun-B

Jun-B Human Purified
  Abnova Taiwan Corp.

Jun-B

Jun-B Human Purified
  Abnova Taiwan Corp.

Jun-B

Jun-B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Jun-B

Jun-B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Jun-B (1 products)

Catalog No. Species Pres. Purity   Source  

JUNB 293T Cell Transient Overexpression Lysate(Denatured)

JUNB 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn