TA335848 Inhibin alpha / INHA antibody

Rabbit Polyclonal Anti-INHA Antibody

See related secondary antibodies

Search for all "Inhibin alpha / INHA"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Goat, Human, Porcine, Rat, Sheep Inhibin alpha / INHA

Product Description for Inhibin alpha / INHA

Rabbit anti Bovine, Canine, Equine, Goat, Human, Porcine, Rat, Sheep Inhibin alpha / INHA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Inhibin alpha / INHA

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, Gt, Hu, Por, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P05111
Immunogen:
The immunogen for Anti-INHA Antibody: synthetic peptide directed towards the N terminal of human INHA. Synthetic peptide located within the following region: GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP.
GeneID:
3623
Application WB
Background INHA joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate godal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in godal and various extragodal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. The inhibin alpha subunit joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate godal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in godal and various extragodal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Inhibin alpha / INHA (14 products)

Catalog No. Species Pres. Purity   Source  

Inhibin alpha / INHA (233-366)

Inhibin alpha / INHA Human Purified > 95.0% as determined by both RP-HPLC and SDS-PAGE analysis E. coli
  OriGene Technologies GmbH

Inhibin alpha / INHA (233-366)

Inhibin alpha / INHA Human Purified > 95.0% as determined by both RP-HPLC and SDS-PAGE analysis E. coli
  OriGene Technologies GmbH

Inhibin alpha / INHA (233-366)

Inhibin alpha / INHA Human Purified > 95.0% as determined by both RP-HPLC and SDS-PAGE analysis E. coli
  OriGene Technologies GmbH

Inhibin alpha / INHA (233-366, His-tag)

Inhibin alpha / INHA Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

Inhibin alpha / INHA (233-366, His-tag)

Inhibin alpha / INHA Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

Inhibin alpha / INHA

Inhibin alpha / INHA Human
  Abnova Taiwan Corp.

Inhibin alpha / INHA

Inhibin alpha / INHA Human 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Inhibin alpha / INHA

Inhibin alpha / INHA Human 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Inhibin alpha / INHA

Inhibin alpha / INHA Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Inhibin alpha / INHA

Inhibin alpha / INHA Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Inhibin alpha / INHA

Inhibin alpha / INHA Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Inhibin alpha / INHA

Inhibin alpha / INHA Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Inhibin alpha / INHA

Inhibin alpha / INHA Human Purified 95 % E. coli
  GenWay Biotech Inc.

Inhibin alpha / INHA

Inhibin alpha / INHA Human Purified 95 % E. coli
  GenWay Biotech Inc.

Positive controls for Inhibin alpha / INHA (1 products)

Catalog No. Species Pres. Purity   Source  

INHA overexpression lysate

INHA overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn