TA335857 EIF5A1 antibody

Rabbit Polyclonal Anti-EIF5A Antibody

See related secondary antibodies

Search for all "EIF5A1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep EIF5A1

Product Description for EIF5A1

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep EIF5A1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EIF5A1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Eukaryotic initiation factor 5A isoform 1, Eukaryotic translation initiation factor 5A-1, Rev-binding factor, eIF-4D, eIF-5A, eIF-5A-1, eIF-5A1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P63241
Immunogen:
The immunogen for Anti-EIF5A Antibody is: synthetic peptide directed towards the N-terminal region of Human EIF5A. Synthetic peptide located within the following region: LKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVP.
GeneID:
1984
Application WB
Background EIF5A is a mR-binding protein involved in translation elongation. It has an important function at the level of mR turnover, probably acting downstream of decapping. It is involved in actin dymics and cell cycle progression, mR decay and probably in a pathway involved in stress response and maintence of cell wall integrity. With syntenin SDCBP, EIF5A functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. EIF5A regulates also TNF-alpha-mediated apoptosis and mediates effects of polyamines on neurol process extension and survival. It may play an important role in brain development and function, and in skeletal muscle stem cell differentiation. EIF5A is also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mR export of retroviral transcripts.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for EIF5A1 (10 products)

Catalog No. Species Pres. Purity   Source  

EIF5A1 (transcript variant B)

EIF5A1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

EIF5A1 (transcript variant C)

EIF5A1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

EIF5A1 (transcript variant D)

EIF5A1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

EIF5A1 (1-154)

EIF5A1 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

EIF5A1 (1-154)

EIF5A1 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

EIF5A1

EIF5A1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EIF5A1

EIF5A1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EIF5A1

EIF5A1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EIF5A1

EIF5A1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EIF5A1

SDS-Page: eIF5A Protein [NBC1-21053] - eIF5A, 16.8 kDa (154 aa) , confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Affinity purified
  Novus Biologicals Inc.

Positive controls for EIF5A1 (2 products)

Catalog No. Species Pres. Purity   Source  

eIF5A Lysate

Western Blot: eIF5A Lysate [NBL1-10214] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for EIF5A
  Novus Biologicals Inc.

EIF5A overexpression lysate

EIF5A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn