DLX4 / BP1 - TA335858 | acris-antibodies.com

Product Description for DLX4 / BP1

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine, Rabbit, Rat DLX4 / BP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DLX4 / BP1

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	Beta protein 1, DLX-7, DLX-8, DLX7, DLX8, DLX9, Homeobox protein DLX-4
Presentation	Purified
Reactivity	Bov, Can, GP, Hu, Por, Rb, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: Q92988 Immunogen: The immunogen for Anti-DLX4 Antibody: synthetic peptide directed towards the middle region of human DLX4. Synthetic peptide located within the following region: ERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVS. GeneID: 1748
Application	WB
Background	DLX4 is a member of the family of Dlx genes that are involved in early vertebrate morphogenesis, notably of the head.Western blots using several different antibodies against different unique regions of this protein target confirm the same apparent molecular weight in our tests.Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. Three transcript variants have been described for this gene, however, the full length ture of one variant has not been described. Studies of the two splice variants revealed that one encoded isoform functions as a repressor of the beta-globin gene while the other isoform lacks that function.
Format	Purification: Affinity Purified Buffer System: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DLX4 / BP1 (9 products)

Catalog No.	Species	Pres.	Purity	Source
TP760063	DLX4 / BP1 (full length, N-term HIS tag, transcript variant 1)
	Human		> 80 % Preparation: . Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	E. coli	50 µg / €205.00
					OriGene Technologies, Inc.
AR10387PU-L	DLX4 / BP1
	Human	Purified		E. coli
					OriGene Technologies GmbH
AR10387PU-N	DLX4 / BP1
	Human	Purified		E. coli
					OriGene Technologies GmbH
AR10387PU-S	DLX4 / BP1
	Human	Purified		E. coli
					OriGene Technologies GmbH
H00001748-P01	DLX4 / BP1
	Human
					Abnova Taiwan Corp.
H00001748-P01-10	DLX4 / BP1
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00001748-P01-25	DLX4 / BP1
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00001748-Q01-10	DLX4 / BP1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00001748-Q01-25	DLX4 / BP1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.

Positive controls for DLX4 / BP1 (6 products)

Catalog No.	Species	Purity
NBL1-09919	BP1 Lysate

			Novus Biologicals Inc.
NBL1-09920	BP1 Lysate

			Novus Biologicals Inc.
H00001748-T01	DLX4 293T Cell Transient Overexpression Lysate(Denatured)

			Abnova Taiwan Corp.
L070T6	DLX4 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)
		Transient overexpression cell lysate was tested with Anti-DLX4 antibody (H00001748-M01) by Western Blots.
			Abnova Taiwan Corp.
LY403346	DLX4 overexpression lysate
			0.1 mg / €295.00
			OriGene Technologies, Inc.
LY419636	DLX4 overexpression lysate
			0.1 mg / €295.00
			OriGene Technologies, Inc.

Recommended Secondary Antibodies for DLX4 / BP1 (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH