TA335864 ADAM2 / FTNB antibody

Rabbit Polyclonal Anti-ADAM2 Antibody

See related secondary antibodies

Search for all "ADAM2 / FTNB"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ADAM2 / FTNB

Product Description for ADAM2 / FTNB

Rabbit anti Human ADAM2 / FTNB.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ADAM2 / FTNB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cancer/testis antigen 15, Disintegrin and metalloproteinase domain-containing protein 2, Fertilin subunit beta, PH-30, PH30-beta
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99965
Immunogen:
Synthetic peptide directed towards the middle region of human ADAM2
AA Sequence:
PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL
GeneID:
2515
Application Western blotting (0.2 - 1.0 µg/ml)
Background ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.
General Readings Eto,K., (2002) J. Biol. Chem. 277 (20), 17804-17810
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for ADAM2 / FTNB (5 products)

Catalog No. Species Pres. Purity   Source  

ADAM2 / FTNB

ADAM2 / FTNB Human
  Abnova Taiwan Corp.

ADAM2 / FTNB

ADAM2 / FTNB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ADAM2 / FTNB

ADAM2 / FTNB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ADAM2 / FTNB

ADAM2 / FTNB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ADAM2 / FTNB

ADAM2 / FTNB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ADAM2 / FTNB (2 products)

Catalog No. Species Pres. Purity   Source  

ADAM2 293T Cell Transient Overexpression Lysate(Denatured)

ADAM2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ADAM2 overexpression lysate

ADAM2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn