TA335865 FHL1 antibody

Rabbit Polyclonal Anti-FHL1 Antibody

See related secondary antibodies

Search for all "FHL1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Sheep FHL1

TA335865

More Views

  • TA335865
  • TA335865

Product Description for FHL1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Sheep FHL1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for FHL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FHL-1, FHL1, Four and a half LIM domains protein 1, SLIM, SLIM-1, SLIM1, Skeletal Muscle LIM-protein 1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Sh
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13642
Immunogen:
The immunogen for Anti-FHL1 Antibody: synthetic peptide directed towards the C terminal of human FHL1. Synthetic peptide located within the following region: YYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCS.
GeneID:
2273
Application WB
IHC
Background LIM proteins, med for 'LIN11, ISL1, and MEC3,' are defined by the possession of a highly conserved double zinc finger motif called the LIM domain. FHL1 may play an important role during the early stages of skeletal muscle differentiation, specifically in alpha5beta1-integrin-mediated sigling pathways.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FHL1 (9 products)

Catalog No. Species Pres. Purity   Source  

FHL1

FHL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FHL1 (transcript variant 6)

FHL1 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FHL1 (transcript variant 5)

FHL1 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FHL1 (transcript variant 3)

FHL1 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FHL1 (transcript variant 4)

FHL1 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FHL1

FHL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FHL1

FHL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FHL1

FHL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FHL1

FHL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for FHL1 (7 products)

Catalog No. Species Pres. Purity   Source  

FHL1 293T Cell Transient Overexpression Lysate(Denatured)

FHL1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FHL1 Lysate

Western Blot: FHL1 Lysate [NBL1-10714] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FHL1
  Novus Biologicals Inc.

FHL1 overexpression lysate

FHL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

FHL1 overexpression lysate

FHL1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

FHL1 overexpression lysate

FHL1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

FHL1 overexpression lysate

FHL1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

FHL1 overexpression lysate

FHL1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn