TA335871 Cysteine-rich protein 2 antibody

Rabbit Polyclonal Anti-CRIP2 Antibody

See related secondary antibodies

Search for all "Cysteine-rich protein 2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat Cysteine-rich protein 2

Product Description for Cysteine-rich protein 2

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat Cysteine-rich protein 2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cysteine-rich protein 2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CRIP2, CRP2, Protein ESP1
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P52943
Immunogen:
The immunogen for Anti-CRIP2 Antibody: synthetic peptide directed towards the N terminal of human CRIP2. Synthetic peptide located within the following region: EKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCP.
GeneID:
1397
Application WB
Background Human ESP1/CRP2 protein has two LIM domains, and each shares 35.1% and 77 or 79% identical residues with human cysteine-rich protein (CRP) and rat CRIP, respectively. Northern blot alysis of ESP1/CRP2 in various human tissues showed distinct tissue distributions compared with CRP and CRIP, suggesting that each might serve related but specific roles in tissue organization or function. Using a panel of human-rodent somatic cell hybrids, the ESP1/CRP2 locus was assigned to chromosome 14. Fluorescence in situ hybridization, using cD and a genome D fragment of the ESP1/CRP2 as probes, confirms this assignment and relegates regiol localization to band 14q32.3.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Cysteine-rich protein 2 (8 products)

Catalog No. Species Pres. Purity   Source  

Cysteine-rich protein 2

Cysteine-rich protein 2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Cysteine-rich protein 2

Cysteine-rich protein 2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cysteine-rich protein 2

Cysteine-rich protein 2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cysteine-rich protein 2

Cysteine-rich protein 2 Human Purified
  Abnova Taiwan Corp.

Cysteine-rich protein 2

Cysteine-rich protein 2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cysteine-rich protein 2

Cysteine-rich protein 2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cysteine-rich protein 2

Cysteine-rich protein 2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cysteine-rich protein 2

Cysteine-rich protein 2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Cysteine-rich protein 2 (2 products)

Catalog No. Species Pres. Purity   Source  

CRIP2 Lysate

Western Blot: CRIP2 Lysate [NBL1-09478] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CRIP2
  Novus Biologicals Inc.

CRIP2 overexpression lysate

CRIP2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn