TA335874 Choline kinase alpha antibody

Rabbit Polyclonal Anti-CHKA Antibody

See related secondary antibodies

Search for all "Choline kinase alpha"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Choline kinase alpha

TA335874

More Views

  • TA335874

Product Description for Choline kinase alpha

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Choline kinase alpha.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Choline kinase alpha

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CHETK-alpha, CHK, CHKA, CKI, Ethanolamine kinase
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P35790
Immunogen:
The immunogen for Anti-CHKA Antibody: synthetic peptide directed towards the middle region of human CHKA. Synthetic peptide located within the following region: LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI.
GeneID:
1119
Application WB
Background The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. CHKA is the initial enzyme in the sequence and may play a regulatory role. It also catalyzes the phosphorylation of ethanolamine.The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. The protein encoded by this gene is the initial enzyme in the sequence and may play a regulatory role. The encoded protein also catalyzes the phosphorylation of ethanolamine. Two transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Choline kinase alpha (9 products)

Catalog No. Species Pres. Purity   Source  

Choline kinase alpha (transcript variant 2)

Choline kinase alpha Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Choline kinase alpha

Choline kinase alpha Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Choline kinase alpha

Choline kinase alpha Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Choline kinase alpha

Choline kinase alpha Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Choline kinase alpha

Choline kinase alpha Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Choline kinase alpha

Choline kinase alpha Human
  Abnova Taiwan Corp.

Choline kinase alpha

Choline kinase alpha Human
  Abnova Taiwan Corp.

Choline kinase alpha

Choline kinase alpha Human
  Abnova Taiwan Corp.

Choline kinase alpha

Choline kinase alpha
  Abnova Taiwan Corp.

Positive controls for Choline kinase alpha (4 products)

Catalog No. Species Pres. Purity   Source  

CHKA 293T Cell Transient Overexpression Lysate(Denatured)

CHKA 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CHKA overexpression lysate

CHKA overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

CHKA overexpression lysate

CHKA overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Choline kinase alpha Lysate

Western Blot: Choline kinase alpha Lysate [NBL1-09157] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for CHKA.
  Novus Biologicals Inc.
  • LinkedIn