TA335876 DHRS12 antibody

Rabbit Polyclonal Anti-DHRS12 Antibody

See related secondary antibodies

Search for all "DHRS12"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Zebrafish DHRS12

Product Description for DHRS12

Rabbit anti Bovine, Human, Zebrafish DHRS12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DHRS12

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Dehydrogenase/reductase SDR family member 12
Presentation Purified
Reactivity Bov, Hu, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A0PJE2
Immunogen:
The immunogen for Anti-DHRS12 Antibody is: synthetic peptide directed towards the C-terminal region of Human DHRS12. Synthetic peptide located within the following region: VSSGGMLVQKLNTNDLQSERTPFDGTMVYAQNKRQQVVLTERWAQGHPAI.
GeneID:
79758
Application WB
Background This gene encodes a member of the short-chain dehydrogeses/reductases (SDR) family, which has over 46,000 members. Members in this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids and xenobiotics. Altertive splicing results in multiple transcript variants and protein isoforms.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for DHRS12 (4 products)

Catalog No. Species Pres. Purity   Source  

DHRS12 Lysate

Western Blot: DHRS12 Lysate [NBL1-09866] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DHRS12
  Novus Biologicals Inc.

DHRS12 overexpression lysate

DHRS12 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DHRS12 overexpression lysate

DHRS12 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DHRS12 overexpression lysate

DHRS12 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn