TA335880 FAM115A antibody

Rabbit Polyclonal Anti-FAM115A Antibody

See related secondary antibodies

Search for all "FAM115A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat FAM115A

Product Description for FAM115A

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat FAM115A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM115A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0738
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y4C2
Immunogen:
The immunogen for Anti-FAM115A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM115A. Synthetic peptide located within the following region: FTEYRNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVAT.
GeneID:
9747
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM115A (3 products)

Catalog No. Species Pres. Purity   Source  

FAM115A

FAM115A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

FAM115A

FAM115A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FAM115A

FAM115A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn