TA335885 DCAF17 antibody

Rabbit Polyclonal Anti-DCAF17 Antibody

See related secondary antibodies

Search for all "DCAF17"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat DCAF17

Product Description for DCAF17

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat DCAF17.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DCAF17

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C2orf37, DDB1- and CUL4-associated factor 17
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5H9S7
Immunogen:
The immunogen for Anti-DCAF17 Antibody is: synthetic peptide directed towards the N-terminal region of Human DCAF17. Synthetic peptide located within the following region: FDNYRRCVSSVASEPRKLYEMPKCSKSEKIEDALLWECPVGDILPNSSDY.
GeneID:
80067
Application WB
Background This gene encodes a nuclear transmembrane protein that associates with cullin 4A/damaged D binding protein 1 ubiquitin ligase complex. Mutations in this gene are associated with Woodhouse-Sakati syndrome. Alterte splicing results in multiple transcript variants.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn