TA335890 SAP130 antibody

Rabbit Polyclonal Anti-SAP130 Antibody

See related secondary antibodies

Search for all "SAP130"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat SAP130

Product Description for SAP130

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat SAP130.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SAP130

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 130 kDa Sin3-associated polypeptide, Histone deacetylase complex subunit SAP130, Sin3-associated polypeptide p130
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H0E3
Immunogen:
The immunogen for Anti-SAP130 Antibody is: synthetic peptide directed towards the C-terminal region of Human SAP130. Synthetic peptide located within the following region: ANNLSMPTSDLPPGASPRKKPRKQQHVISTEEGDMMETNSTDDEKSTAKS.
GeneID:
79595
Application WB
Background SAP130 is a subunit of the histone deacetylase-dependent SIN3A corepressor complex.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn