TA335898 CIZ1 antibody

Rabbit Polyclonal Anti-CIZ1 Antibody

See related secondary antibodies

Search for all "CIZ1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat CIZ1

Product Description for CIZ1

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat CIZ1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CIZ1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CDKN1A-interacting zinc finger protein 1, Cip1-interacting zinc finger protein, LSFR1, NP94, Nuclear protein NP94, ZNF356, Zinc finger protein 356
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9ULV3
Immunogen:
The immunogen for Anti-CIZ1 Antibody: synthetic peptide directed towards the middle region of human CIZ1. Synthetic peptide located within the following region: YICRICHKFYHSNSGAQLSHCKSLGHFENLQKYKAAKNPSPTTRPVSRRC.
GeneID:
25792
Application WB
Background CIZ1 may regulate the subcellular localization of CIP/WAF1.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CIZ1 (3 products)

Catalog No. Species Pres. Purity   Source  

CIZ1 (transcript variant 1)

CIZ1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CIZ1

CIZ1 Human Purified
  Abnova Taiwan Corp.

CIZ1

CIZ1 Human Purified
  Abnova Taiwan Corp.

Positive controls for CIZ1 (1 products)

Catalog No. Species Pres. Purity   Source  

CIZ1 293T Cell Transient Overexpression Lysate(Denatured)

CIZ1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn