TA335900 CPSF4L antibody

Rabbit Polyclonal Anti-CPSF4L Antibody

See related secondary antibodies

Search for all "CPSF4L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human, Rabbit, Rat CPSF4L

Product Description for CPSF4L

Rabbit anti Equine, Human, Rabbit, Rat CPSF4L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CPSF4L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Putative cleavage and polyadenylation specificity factor subunit 4-like protein
Presentation Purified
Reactivity Eq, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NMK7
Immunogen:
The immunogen for Anti-CPSF4L Antibody is: synthetic peptide directed towards the N-terminal region of Human CPSF4L. Synthetic peptide located within the following region: EKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHDRGEKM.
GeneID:
642843
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CPSF4L (1 products)

Catalog No. Species Pres. Purity   Source  

CPSF4L overexpression lysate

CPSF4L overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn