TA335902 FANCL antibody

Rabbit Polyclonal Anti-FANCL Antibody

See related secondary antibodies

Search for all "FANCL"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FANCL

TA335902

More Views

  • TA335902
  • TA335902

Product Description for FANCL

Rabbit anti Human FANCL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FANCL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms E3 ubiquitin-protein ligase FANCL, FAAP43, Fanconi anemia group L protein, Fanconi anemia-associated polypeptide of 43 kDa, PHF9
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NW38
Immunogen:
The immunogen for Anti-FANCL Antibody: synthetic peptide directed towards the middle region of human FANCL. Synthetic peptide located within the following region: ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY.
GeneID:
55120
Application WB
Background The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FAN
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FANCL (2 products)

Catalog No. Species Pres. Purity   Source  

FANCL

FANCL Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FANCL

FANCL Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for FANCL (4 products)

Catalog No. Species Pres. Purity   Source  

FANCL 293T Cell Transient Overexpression Lysate(Denatured)

FANCL 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FANCL 293T Cell Transient Overexpression Lysate(Denatured)

FANCL 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FANCL Lysate

Western Blot: FANCL Lysate [NBL1-10590] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FANCL
  Novus Biologicals Inc.

FANCL overexpression lysate

FANCL overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn