TA335916 FAM156A antibody

Rabbit Polyclonal Anti-FAM156B Antibody

See related secondary antibodies

Search for all "FAM156A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FAM156A

Product Description for FAM156A

Rabbit anti Human FAM156A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM156A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms TMEM29, Transmembrane protein 29
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NDB6
Immunogen:
The immunogen for Anti-FAM156B Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM156B. Synthetic peptide located within the following region: PGPSQAVPLPEGLLRQRYREEKTLEERRWERLEFLQRKKAFLRHVRRRHR.
GeneID:
29057
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM156A (2 products)

Catalog No. Species Pres. Purity   Source  

FAM156A

FAM156A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FAM156A

FAM156A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for FAM156A (2 products)

Catalog No. Species Pres. Purity   Source  

FAM156A overexpression lysate

FAM156A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

FAM156B overexpression lysate

FAM156B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn