TA335917 DCDC2B antibody

Rabbit Polyclonal Anti-DCDC2B Antibody

See related secondary antibodies

Search for all "DCDC2B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat DCDC2B

Product Description for DCDC2B

Rabbit anti Human, Rat DCDC2B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DCDC2B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Doublecortin domain-containing protein 2B
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A2VCK2
Immunogen:
The immunogen for Anti-DCDC2B Antibody is: synthetic peptide directed towards the N-terminal region of Human DCDC2B. Synthetic peptide located within the following region: RGQYVAAGFERFHKLHYLPHRGKDPGGKSCRLQGPPVTRHLCDGAIGRQL.
GeneID:
149069
Application WB
Background This gene encodes a member of the doublecortin family. The protein encoded by this gene contains two doublecortin domains. The doublecortin domain has been demonstrated to bind tubulin and enhance microtubule polymerization.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn