TA335922 Selenoprotein P (SEPP1) antibody

Rabbit Polyclonal Anti-SEPP1 Antibody

See related secondary antibodies

Search for all "Selenoprotein P (SEPP1)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Selenoprotein P (SEPP1)

Product Description for Selenoprotein P (SEPP1)

Rabbit anti Human Selenoprotein P (SEPP1).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Selenoprotein P (SEPP1)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SELP
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P49908
Immunogen:
The immunogen for Anti-SEPP1 Antibody: synthetic peptide directed towards the N terminal of human SEPP1. Synthetic peptide located within the following region: LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL.
GeneID:
6414
Application WB
Background SEPP1 is a selenoprotein containing multiple selenocysteine (Sec) residues, which are encoded by the UGA codon that normally sigls translation termition. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop sigl. This selenoprotein is an extracellular glycoprotein, and is unusual in that it contains 10 Sec residues per polypeptide. It is a heparin-binding protein that appears to be associated with endothelial cells, and has been implicated to function as an antioxidant in the extracellular space.This gene encodes a selenoprotein containing multiple selenocysteine (Sec) residues, which are encoded by the UGA codon that normally sigls translation termition. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop sigl. This selenoprotein is an extracellular glycoprotein, and is unusual in that it contains 10 Sec residues per polypeptide. It is a heparin-binding protein that appears to be associated with endothelial cells, and has been implicated to function as an antioxidant in the extracellular space. Several transcript variants, encoding either the same or different isoform, have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn